PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0134s00540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TCP
Protein Properties Length: 126aa    MW: 13547.5 Da    PI: 6.7924
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0134s00540.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP79.68.3e-251502473
                TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                       +++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++a+++
  Vradi0134s00540.1  1 MPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPATFS 50
                       9*****************************************99999666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136920.861139IPR017887Transcription factor TCP subgroup
PfamPF036349.4E-20155IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MPIICAARVF QLTRELGHKS DGQTIEWLLR QAEPSIIAAT GTGTTPATFS TVSDHKPLLP  60
PPTPFILGKR IRPDDTDAVS KDEAVSLVAP PTPPALWALP PRPDFSQFLR GEVHELRNSI  120
GLGFS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150431e-160AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490975.16e-72PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX24e-44TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A0L9UTP76e-72A0A0L9UTP7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T0J36e-72A0A0S3T0J3_PHAAN; Uncharacterized protein
STRINGGLYMA09G42140.27e-58(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54693153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.12e-23TCP family protein